PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G142300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARF
Protein Properties Length: 788aa    MW: 86975 Da    PI: 6.6509
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G142300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.94.6e-24156257199
                          EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                          f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F  
  Manes.11G142300.1.p 156 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL- 243
                          99****************************963.3445679************************************************. PP

                          -SSSEE..EEEEE-S CS
                   B3  85 dgrsefelvvkvfrk 99 
                           + +++el+++++r+
  Manes.11G142300.1.p 244 -RGEDGELRLGIRRA 257
                          .449999*****996 PP

2Auxin_resp125.43.9e-41282363182
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                          +a+a+st+s+F+v+Y+Pras++eFvv+++k++k++ ++v++G+Rfkm+fe++ds+err+sG+v+g+sdldp+rWpnSkWr+L
  Manes.11G142300.1.p 282 VANAMSTNSMFNVLYSPRASHAEFVVPYKKYMKSIMNPVCIGTRFKMRFEMDDSPERRCSGVVTGISDLDPYRWPNSKWRCL 363
                          689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-44148268IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.3E-41150268IPR015300DNA-binding pseudobarrel domain
CDDcd100175.19E-23154256No hitNo description
PfamPF023623.2E-22156257IPR003340B3 DNA binding domain
SMARTSM010195.4E-24156258IPR003340B3 DNA binding domain
PROSITE profilePS5086312.999156258IPR003340B3 DNA binding domain
PfamPF065071.0E-34282363IPR010525Auxin response factor
PfamPF023092.8E-6656747IPR033389AUX/IAA domain
SuperFamilySSF542775.76E-10659742No hitNo description
PROSITE profilePS5174521.017663747IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
MEIDLNHAVT EVEKNAFCTN GDSSSSSCSS NSAPSPLPSS IYLELWHACA GPLTLLPKKG  60
NVVVYFPQGH LEQVASSAPF SPMEMPTFDL QPQIFCKVVN VQLLANKEND EVYTQLTLLP  120
QPQLVGQDLE GKELEELVVD EEGGGRLPAK STPHMFCKTL TASDTSTHGG FSVPRRAAED  180
CFPPLDYKQQ RPSQELVAKD LHGVEWRFRH IYRGQPRRHL LTTGWSIFVS QKNLVSGDAV  240
LFLRGEDGEL RLGIRRAVRP RNGLPDSVIG KQNSYPSVLS VVANAMSTNS MFNVLYSPRA  300
SHAEFVVPYK KYMKSIMNPV CIGTRFKMRF EMDDSPERRC SGVVTGISDL DPYRWPNSKW  360
RCLMVRWDED IVSDHQDRVS PWEIDPSVSL PPLSIQSSPR LKKLRTGLSA TPPDNPITGG  420
GGFLDFEESG RSSKVLQGQE NVGFASPLYG RDTLNRPPDF GMQNMAHQNL VSTGREKADI  480
GEITRARSTT YTGFAESDRF PKVLQGQEIC PLRSLTGKSD LNLSAWCRPN LGCGPFNTYQ  540
APRPSFYPLA AESLQKMYIT YGDLHKTGQD PRMSSYATKF PREKLPFDAS SVQTGAARDV  600
VGKPNQSSEH KSQEIISASP GLGANLINQK ENSFNGTASG CKLFGFSLTA DSPTPNSQNS  660
GKRSCTKVHK QGSLVGRAID LSRLNGYGDL LNELERLFSM EGFLRDHNKG WRILYTDSEN  720
DVMVVGDDPW HEFCNVVSKI HIYTQEEVEK MSIGVIGDDT QSCLDQAPVV LEASKSSSVG  780
QPDSSPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-122243862354Auxin response factor 1
4ldy_B1e-122243862354Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012064855.10.0PREDICTED: auxin response factor 4
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A067LHL50.0A0A067LHL5_JATCU; Auxin response factor
STRINGVIT_06s0004g03130.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52363252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4